PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG632900.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bHLH
Protein Properties Length: 246aa    MW: 27043.3 Da    PI: 6.4174
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG632900.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH45.71.2e-1472124155
                          CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                  HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                          r+ +hn+ Er RR+++N+ ++ Lr+llP a   + kKls  +++ ++ +YI +Lq
  Pavir.5NG632900.4.p  72 RKHSHNAYERDRRKQLNELYSSLRSLLPDA--DHTKKLSIPTTVSRVLKYIPELQ 124
                          6899*************************7..35666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474592.49E-1668139IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000833.75E-1171127No hitNo description
PROSITE profilePS5088814.11971123IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.106.5E-1372139IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000106.8E-1272124IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003535.1E-1077129IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MEHQLFDDPF SSSISSLEAD IFSAGGQLPS PPWPDLDLDL DDDDIHDLSA PTGNPTSSGG  60
YGSGGGSGGS HRKHSHNAYE RDRRKQLNEL YSSLRSLLPD ADHTKKLSIP TTVSRVLKYI  120
PELQKQVDNL ERRKKELTNA NCKPGVLNTS QIVTPIVSAT CLNDTEIMVQ VSLHSNVAAT  180
SLPLSKCIKV MENEGLHLIS SSTYSTFDNR TFYSLHVQRS QRTMKEECPA FCDELERIIK  240
KKAGA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.34520.0callus| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971295.11e-141PREDICTED: transcription factor ORG3-like
TrEMBLK3XLE71e-141K3XLE7_SETIT; Uncharacterized protein
STRINGSi002720m1e-141(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04150.11e-29bHLH family protein